PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007535P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 338aa    MW: 35164.7 Da    PI: 8.5656
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007535P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-3966124361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  MELO3C007535P1  66 GQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKSA 124
                     57899***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2565122IPR003851Zinc finger, Dof-type
PfamPF027018.4E-3367123IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51669123IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MIQELFGVSG LLAAAGDTKI SINNTCSILD SSPSTSLSAS ATAATNATNA TATTTATATT  60
SSNSEGQNLR CPRCDSSNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK  120
NKSAAATVAA AVGKSTSGKM KTLSSEILGR VGFGNGSALD HEIISSPTQI LWGSPQNSHL  180
LAILRSATQN PNPNNLAASH VISNDPPPST TPFHARTTGF DDPPAGTHVS SLGLCSSYWR  240
NNQNQVHHQQ NGYPHGGGDQ VHGGASGIQE LYQKLKSSSN NYFTDGHQGS VGVTNVATTA  300
TAAILEAAPV GGGEMTGFWN PAFTWSDVHA SANGAYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440237.10.0PREDICTED: dof zinc finger protein DOF5.3-like
TrEMBLA0A0A0KGA60.0A0A0A0KGA6_CUCSA; F-box family protein
STRINGPOPTR_0007s11620.18e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-33DOF zinc finger protein 1